PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_014805-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 158aa    MW: 18968.8 Da    PI: 10.1243
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_014805-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.71e-3281139159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  NNU_014805-RA  81 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHIHS 139
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.6E-3466139IPR003657WRKY domain
SuperFamilySSF1182906.41E-2973140IPR003657WRKY domain
PROSITE profilePS5081129.47176141IPR003657WRKY domain
SMARTSM007746.1E-3781140IPR003657WRKY domain
PfamPF031061.4E-2582138IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MQKYQEIALS LSLSLQFSHL LVWFWLELRP WVQDSERLSG KRYGEDEHMG VSAMKMKKVK  60
ARRKVREPRF CFKTMSDVDV LDDGYKWRKY GQKVVKNTQH PRSYYRCTQD NCRVKKRVER  120
LAEDPRMVIT TYEGRHIHSP SHDLDNSQAP PQISNFFW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-2872138874Probable WRKY transcription factor 4
2lex_A9e-2872138874Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3798942e-67AB379894.1 Nelumbo nucifera DNA, microsatellite locus NS090.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010268590.12e-95PREDICTED: probable WRKY transcription factor 13
SwissprotQ9SVB72e-62WRK13_ARATH; Probable WRKY transcription factor 13
TrEMBLA0A061DJ429e-82A0A061DJ42_THECC; WRKY DNA-binding protein 13
STRINGVIT_07s0031g01840.t011e-79(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.19e-54WRKY DNA-binding protein 13